PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010943150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 379aa    MW: 42197.8 Da    PI: 4.3827
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010943150.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM45.72.1e-14239950128
             NAM  50 kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++ee+ wy + ++d ++ +g+ +  +t+ gyWk+  +d ++++ ++ +vg k++  fy g+ap+g++t W+mhey++
  XP_010943150.1  23 CIYSEEDIWYLYNPEDPQSLNGDSEFNVTRIGYWKSR-NDLRIFT-GTPTVGRKTMREFYVGKAPNGNRTGWMMHEYQA 99 
                     56778889***************************76.6688888.8999***************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100522.4951122IPR003441NAC domain
SuperFamilySSF1019416.93E-1925122IPR003441NAC domain
PfamPF023651.4E-63198IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MEFSWLALDH TYELPLFSLI LLCIYSEEDI WYLYNPEDPQ SLNGDSEFNV TRIGYWKSRN  60
DLRIFTGTPT VGRKTMREFY VGKAPNGNRT GWMMHEYQAE QKTINGINKE QDYSSLCRVF  120
LQIDERPNHE EQHNSAIADG AECDYVEYAL LNILEQEENN LSSRDAENRS QTIGGDEQGQ  180
SVLSGTSVTD PITDDRFEEK YATCDFSKGD YLELNDLCSS ETSSSSSDNS SLMSVNSDEF  240
FDADALLRDL ENDHNVRVEE EHGECRYNVS ASVKSNRVVI MPPTPGSVCS NSRSNLVVEG  300
GTSANPIPEE ARASEPSPSA DELSHSGRAS DSGKSPDSHS DQSSSDSSHG SRTSKGQGSK  360
SAGRIAKLGK KYYCCFRSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-122312066163NAC domain-containing protein 19
4dul_A4e-122312066163NAC domain-containing protein 19
1ut7_B4e-122312066163NO APICAL MERISTEM PROTEIN
1ut7_A4e-122312066163NO APICAL MERISTEM PROTEIN
1ut4_B4e-122312066163NO APICAL MERISTEM PROTEIN
1ut4_A4e-122312066163NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010943150.10.0PREDICTED: NAC domain-containing protein 78-like isoform X3
TrEMBLM0TKU19e-84M0TKU1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P26050_0013e-83(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.12e-16NAC domain containing protein 57